McDonnell Genome Institute

Washington University

Transcript

SPATA3-AS1:9

Chromosome

chr2

Gene Name

SPATA3-AS1

Start

230984367

CPC Label

noncoding

End

230996031

Cancer

OV

Strand

-

Peptide

VPGSMMEEGK

Modified Peptide

n[145]VPGSM[147]M[147]EEGK

Peptide Length

10

ORF Length

37

Open Reading Frame (ORF)

MLLRPERCLQTPLCWRVPGSMMEEGKVFLKDNLKLIL

Conservation Score

0.135

PhyloCSF Frame 1

-2.971

No. of Spectra

26

CPC Coding Probability

0.0988428

PhyloCSF Frame 2 

-3.145

CNTI Index

noncoding

Max Probability

0.9395

PhyloCSF Frame 3

-3.261

CNTI Score

-0.316305257