McDonnell Genome Institute

Washington University

Transcript

SPATA3-AS1:1

Chromosome

chr2

Gene Name

SPATA3-AS1

Start

230985924

CPC Label

noncoding

End

230996048

Cancer

OV

Strand

-

Peptide

GGICQQK

Modified Peptide

n[145]GGICQQK

Peptide Length

7

ORF Length

83

Open Reading Frame (ORF)

LSWDTKSGRLQERGRKMIPALRWAGPAPSVEDLKTKIDPHPSPPTSSSPWKRKTFLRGGICQQKALGLELQHQLFLVPQRPGL

Conservation Score

0.345

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.122229

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4699

PhyloCSF Frame 3

0

CNTI Score

-0.329390804