McDonnell Genome Institute

Washington University

Transcript

SPART-AS1:10

Chromosome

chr13

Gene Name

SPART-AS1

Start

36346431

CPC Label

noncoding

End

36368410

Cancer

CRC

Strand

+

Peptide

LPKPGINELPNEHK

Modified Peptide

‚Äč

Peptide Length

14

ORF Length

41

Open Reading Frame (ORF)

LPKPGINELPNEHKQIWKAFEEEGPLKKVQKECIEIMFIHH

Conservation Score

0.129

PhyloCSF Frame 1

-5.334

No. of Spectra

2

CPC Coding Probability

0.0260446

PhyloCSF Frame 2 

-4.622

CNTI Index

noncoding

Max Probability

0.7504

PhyloCSF Frame 3

-5.829

CNTI Score

-0.384435876