McDonnell Genome Institute

Washington University

Transcript

SPACA6P-AS:1

Chromosome

chr19

Gene Name

SPACA6P-AS

Start

51685362

CPC Label

noncoding

End

51693456

Cancer

OV

Strand

-

Peptide

EQEPVGGK

Modified Peptide

n[145]EQEPVGGK

Peptide Length

8

ORF Length

45

Open Reading Frame (ORF)

LLGTGGREQEPVGGKQVGKLQLPESGPGTDGAGVAFNGELGGRRG

Conservation Score

0.211

PhyloCSF Frame 1

-4.095

No. of Spectra

2

CPC Coding Probability

0.110983

PhyloCSF Frame 2 

-4.295

CNTI Index

noncoding

Max Probability

0.3763

PhyloCSF Frame 3

-3.455

CNTI Score

-0.261127919