McDonnell Genome Institute

Washington University

Transcript

SP2-AS1:1

Chromosome

chr17

Gene Name

SP2-AS1

Start

47898459

CPC Label

noncoding

End

47941410

Cancer

BRCA-Luminal B

Strand

-

Peptide

NVLDTGLVQPVGAGK

Modified Peptide

n[145]NVLDTGLVQPVGAGK

Peptide Length

15

ORF Length

49

Open Reading Frame (ORF)

MHSKMMSIYQPRNVLDTGLVQPVGAGKKFRQIQVSCKKGKLQTYHPMNL

Conservation Score

1

PhyloCSF Frame 1

-4.11

No. of Spectra

12

CPC Coding Probability

0.0888356

PhyloCSF Frame 2 

-4.955

CNTI Index

noncoding

Max Probability

0.9986

PhyloCSF Frame 3

-5.616

CNTI Score

-0.348785056