McDonnell Genome Institute

Washington University

Transcript

SOX2-OT:70

Chromosome

chr3

Gene Name

SOX2-OT

Start

180989772

CPC Label

noncoding

End

181058745

Cancer

HCC

Strand

+

Peptide

QHSLLKGR

Modified Peptide

n[230]QHSLLKGR

Peptide Length

8

ORF Length

38

Open Reading Frame (ORF)

MLAIKLKIFHLLRFLPLLISNFVKQHSLLKGRKLSIGS

Conservation Score

1

PhyloCSF Frame 1

-4.529

No. of Spectra

2

CPC Coding Probability

0.0459737

PhyloCSF Frame 2 

-4.115

CNTI Index

noncoding

Max Probability

0.8535

PhyloCSF Frame 3

-5.723

CNTI Score

-0.360420512