McDonnell Genome Institute

Washington University

Transcript

SOX2-OT:57

Chromosome

chr3

Gene Name

SOX2-OT

Start

181699598

CPC Label

noncoding

End

181836805

Cancer

PRAD

Strand

+

Peptide

DISLPGLCLNTFTEVK

Modified Peptide

DISLPGLCLNTFTEVK

Peptide Length

16

ORF Length

73

Open Reading Frame (ORF)

MTSVDNCGCRKEKTWTVRDISLPGLCLNTFTEVKKQQPNELDSNMIPREWQDQFFNYFFSISETYGRWPIVLS

Conservation Score

0.985

PhyloCSF Frame 1

-5.469

No. of Spectra

1

CPC Coding Probability

0.0654358

PhyloCSF Frame 2 

-4.576

CNTI Index

noncoding

Max Probability

0.9363

PhyloCSF Frame 3

0

CNTI Score

-0.412506781