McDonnell Genome Institute

Washington University

Transcript

SOX2-OT:125

Chromosome

chr3

Gene Name

SOX2-OT

Start

181723192

CPC Label

noncoding

End

181740840

Cancer

OV

Strand

+

Peptide

LPLADSPLCLDLLK

Modified Peptide

n[145]LPLADSPLCLDLLK

Peptide Length

14

ORF Length

49

Open Reading Frame (ORF)

LPLADSPLCLDLLKHLSGENYSLLAYMCVLKNTCSHTHVSSRQQKISTF

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0382659

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.999

PhyloCSF Frame 3

0

CNTI Score

-0.363603811