McDonnell Genome Institute

Washington University

Transcript

SOCS2-AS1:12

Chromosome

chr12

Gene Name

SOCS2-AS1

Start

93532415

CPC Label

noncoding

End

93571768

Cancer

OSCC

Strand

-

Peptide

LVNISQGLCK

Modified Peptide

n[145]LVNISQGLCK

Peptide Length

10

ORF Length

54

Open Reading Frame (ORF)

LVNISQGLCKYCEKCHFVTASAKHQAHPSRDPLNTVLLRGVERCQIAHLLEKPK

Conservation Score

1

PhyloCSF Frame 1

-4.159

No. of Spectra

38

CPC Coding Probability

0.108821

PhyloCSF Frame 2 

-5.64

CNTI Index

noncoding

Max Probability

0.8948

PhyloCSF Frame 3

-5.003

CNTI Score

-0.340441019