McDonnell Genome Institute

Washington University

Transcript

SOCS2-AS1:11

Chromosome

chr12

Gene Name

SOCS2-AS1

Start

93559685

CPC Label

noncoding

End

93571768

Cancer

BRCA-Basal-like

Strand

-

Peptide

TAAGFPSGCDPGGGKER

Modified Peptide

n[145]TAAGFPSGCDPGGGKER

Peptide Length

17

ORF Length

99

Open Reading Frame (ORF)

LGTRCPGMQPAPRSEAAVGVPCAEGTQKPRGSLPRPHPPPRGDAPYGLGHLHSRTAAGFPSGCDPGGGKERGREGGRSEGGRQAGGEEREIRLLGGLLI

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.448597

PhyloCSF Frame 2 

-0.05

CNTI Index

noncoding

Max Probability

0.9261

PhyloCSF Frame 3

0

CNTI Score

-0.256240159