McDonnell Genome Institute

Washington University

Transcript

SNRK-AS1:3

Chromosome

chr3

Gene Name

SNRK-AS1

Start

43346918

CPC Label

coding

End

43351962

Cancer

CCRC

Strand

-

Peptide

TGIQIFHK

Modified Peptide

n[230]TGIQIFHK

Peptide Length

8

ORF Length

50

Open Reading Frame (ORF)

LAPGLWASQRYCFGSVSDTRECVSEPRVSTSQKVRTGIQIFHKEKHFFSL

Conservation Score

1

PhyloCSF Frame 1

-2.643

No. of Spectra

7

CPC Coding Probability

0.667677

PhyloCSF Frame 2 

-2.679

CNTI Index

noncoding

Max Probability

0.9936

PhyloCSF Frame 3

-0.154

CNTI Score

-0.300341293