McDonnell Genome Institute

Washington University

Transcript

SNHG7:12

Chromosome

chr9

Gene Name

SNHG7

Start

136720113

CPC Label

coding

End

136728184

Cancer

OSCC

Strand

-

Peptide

SAMSRTWPTSAGREGR

Modified Peptide

n[145]SAMSRTWPTSAGREGR

Peptide Length

16

ORF Length

72

Open Reading Frame (ORF)

LEACSFSCRDSSSRNSLRCSRAHTDLASARDTRLSLLKSAMSRTWPTSAGREGRSPRFAWRLGPKERKSQLI

Conservation Score

1

PhyloCSF Frame 1

-4.606

No. of Spectra

2

CPC Coding Probability

0.84143

PhyloCSF Frame 2 

11.901

CNTI Index

noncoding

Max Probability

0.6212

PhyloCSF Frame 3

-2.871

CNTI Score

-0.22975378