McDonnell Genome Institute

Washington University

Transcript

SNHG7:1

Chromosome

chr9

Gene Name

SNHG7

Start

136724719

CPC Label

noncoding

End

136728304

Cancer

OV

Strand

-

Peptide

QSLSCPGWSAVAR

Modified Peptide

n[145]QSLSCPGWSAVAR

Peptide Length

13

ORF Length

53

Open Reading Frame (ORF)

LVRLPGDQMQQNAVFFFSRQSLSCPGWSAVARSQLTTTSASWVQATFLLQPPE

Conservation Score

0.089

PhyloCSF Frame 1

0

No. of Spectra

15

CPC Coding Probability

0.121854

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9045

PhyloCSF Frame 3

0

CNTI Score

-0.282914141