McDonnell Genome Institute

Washington University

Transcript

SNHG5:23

Chromosome

chr6

Gene Name

SNHG5

Start

85677468

CPC Label

noncoding

End

85678259

Cancer

OV

Strand

-

Peptide

FPAGTMALSSVAQWSSSEDAKVR

Modified Peptide

n[145]FPAGTM[147]ALSSVAQWSSSEDAKVR

Peptide Length

23

ORF Length

37

Open Reading Frame (ORF)

LECDISARMLKYRFPAGTMALSSVAQWSSSEDAKVRA

Conservation Score

0.883

PhyloCSF Frame 1

-4.428

No. of Spectra

12

CPC Coding Probability

0.0104488

PhyloCSF Frame 2 

-2.087

CNTI Index

noncoding

Max Probability

0.5986

PhyloCSF Frame 3

-1.364

CNTI Score

-0.409066642