McDonnell Genome Institute

Washington University

Transcript

SNHG3:5

Chromosome

chr1

Gene Name

SNHG3

Start

28506350

CPC Label

noncoding

End

28509633

Cancer

OV

Strand

+

Peptide

LDSVNLCVTLIVQR

Modified Peptide

n[145]LDSVNLCVTLIVQR

Peptide Length

14

ORF Length

84

Open Reading Frame (ORF)

LDSVNLCVTLIVQRGYTREVTLPGLCPSGVGEHRALPHDVQVPFHNVGNKAGPRVCACIFLQLPRVLSTITGETNHAGNSLLEH

Conservation Score

1

PhyloCSF Frame 1

-3.07

No. of Spectra

9

CPC Coding Probability

0.0548738

PhyloCSF Frame 2 

1.186

CNTI Index

noncoding

Max Probability

0.9931

PhyloCSF Frame 3

-2.783

CNTI Score

-0.371587085