McDonnell Genome Institute

Washington University

Transcript

SNHG21:18

Chromosome

chr15

Gene Name

SNHG21

Start

82744222

CPC Label

noncoding

End

82750289

Cancer

CCRC

Strand

+

Peptide

MSQAGLK

Modified Peptide

n[230]MSQAGLK

Peptide Length

7

ORF Length

60

Open Reading Frame (ORF)

LRSGVQDQPGQHVETPSLLKIQKMSQAGLKLLTSADPPTSASQGAGTTGVSHHARPLPIL

Conservation Score

0.605

PhyloCSF Frame 1

0

No. of Spectra

31

CPC Coding Probability

0.0204656

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9997

PhyloCSF Frame 3

0

CNTI Score

-0.369252633