McDonnell Genome Institute

Washington University

Transcript

SNHG21:11

Chromosome

chr15

Gene Name

SNHG21

Start

82750571

CPC Label

noncoding

End

82757079

Cancer

BRCA-Luminal B

Strand

+

Peptide

GEGSLHLSR

Modified Peptide

n[145]GEGSLHLSR

Peptide Length

9

ORF Length

53

Open Reading Frame (ORF)

LVGRQAYQVSEDAAGNGSRGEGSLHLSRCVSFGGSAPPATWASFIALTFLHLI

Conservation Score

0.438

PhyloCSF Frame 1

0

No. of Spectra

10

CPC Coding Probability

0.0932967

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9992

PhyloCSF Frame 3

0

CNTI Score

-0.34426843