McDonnell Genome Institute

Washington University

Transcript

SNHG20:1

Chromosome

chr17

Gene Name

SNHG20

Start

77086715

CPC Label

noncoding

End

77099174

Cancer

OV

Strand

+

Peptide

LLLQPGFNR

Modified Peptide

n[145]LLLQPGFNR

Peptide Length

9

ORF Length

50

Open Reading Frame (ORF)

LSRTPSPLLPLRKVPLPLQVVLTGITHTKETWRLPSWGTRLLLQPGFNRK

Conservation Score

0.109

PhyloCSF Frame 1

-2.988

No. of Spectra

5

CPC Coding Probability

0.099783

PhyloCSF Frame 2 

-3.56

CNTI Index

noncoding

Max Probability

0.6941

PhyloCSF Frame 3

-2.782

CNTI Score

-0.411609692