McDonnell Genome Institute

Washington University

Transcript

SNHG16:42

Chromosome

chr17

Gene Name

SNHG16

Start

76558795

CPC Label

coding

End

76562322

Cancer

OSCC

Strand

+

Peptide

LVGAESMMISSYPCLK

Modified Peptide

n[145]LVGAESMMISSYPCLK

Peptide Length

16

ORF Length

41

Open Reading Frame (ORF)

LRVLWLLVLWSSRLVGAESMMISSYPCLKAKKGLSVWNLNI

Conservation Score

1

PhyloCSF Frame 1

-3.337

No. of Spectra

4

CPC Coding Probability

0.60463

PhyloCSF Frame 2 

-5.371

CNTI Index

noncoding

Max Probability

0.7977

PhyloCSF Frame 3

-2.508

CNTI Score

-0.387797053