McDonnell Genome Institute

Washington University

Transcript

SNHG1:43

Chromosome

chr11

Gene Name

SNHG1

Start

62851873

CPC Label

noncoding

End

62855885

Cancer

OV

Strand

-

Peptide

TELSLSDGLVEK

Modified Peptide

n[145]TELSLSDGLVEK

Peptide Length

12

ORF Length

60

Open Reading Frame (ORF)

LLVDLRARWNRRELCCCSKFLRPFLNLCSFVECVEVATGMILRTELSLSDGLVEKTENSE

Conservation Score

1

PhyloCSF Frame 1

-1.622

No. of Spectra

3

CPC Coding Probability

0.0197483

PhyloCSF Frame 2 

-0.998

CNTI Index

noncoding

Max Probability

0.8714

PhyloCSF Frame 3

-3.751

CNTI Score

-0.377002318