McDonnell Genome Institute

Washington University

Transcript

SNAI3-AS1:21

Chromosome

chr16

Gene Name

SNAI3-AS1

Start

88663364

CPC Label

noncoding

End

88677751

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

RVDVMSEDLGGER

Modified Peptide

n[145]RVDVM[147]SEDLGGER

Peptide Length

13

ORF Length

88

Open Reading Frame (ORF)

LLRGPQIYPAQDWEMGGDQDPQGFPRLPPSPRHHWTVTETPASSVLRSCSLLSILAPPPARRKDSDTAPGRGRRVDVMSEDLGGERKA

Conservation Score

0.015

PhyloCSF Frame 1

-3.373

No. of Spectra

29

CPC Coding Probability

0.380599

PhyloCSF Frame 2 

-4.576

CNTI Index

noncoding

Max Probability

0.9999

PhyloCSF Frame 3

-3.757

CNTI Score

-0.282565964