McDonnell Genome Institute

Washington University

Transcript

SNAI3-AS1:13

Chromosome

chr16

Gene Name

SNAI3-AS1

Start

88671805

CPC Label

noncoding

End

88673808

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

VLTVLPSFLR

Modified Peptide

n[145]VLTVLPSFLR

Peptide Length

10

ORF Length

59

Open Reading Frame (ORF)

LKWPAHLIPAKTQVRVLTVLPSFLRVSVGCAESGPRCVRGCVHCHRSLYTSRRGPRAEL

Conservation Score

0.596

PhyloCSF Frame 1

0

No. of Spectra

12

CPC Coding Probability

0.0102646

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9964

PhyloCSF Frame 3

0

CNTI Score

-0.307381005