McDonnell Genome Institute

Washington University

Transcript

SNAI3-AS1:1

Chromosome

chr16

Gene Name

SNAI3-AS1

Start

88663297

CPC Label

noncoding

End

88687186

Cancer

OV

Strand

+

Peptide

LASASAIRGLGAAR

Modified Peptide

n[145]LASASAIRGLGAAR

Peptide Length

14

ORF Length

109

Open Reading Frame (ORF)

LRRRRVPRRLASASAIRGLGAARSGVADVDSWTLLGASALCRLVDAFGENLCSPQLQGQHAFLASSDQGGCSWVLHQNSSSGLSSSGRLTSFLPRPRSVFSQCCHLSSV

Conservation Score

0.155

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.237431

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6704

PhyloCSF Frame 3

0

CNTI Score

-0.292300858