McDonnell Genome Institute

Washington University

Transcript

SMIM15-AS1:21

Chromosome

chr5

Gene Name

SMIM15-AS1

Start

61162101

CPC Label

noncoding

End

61186461

Cancer

OV

Strand

+

Peptide

VQDVYPSTK

Modified Peptide

n[145]VQDVYPSTK

Peptide Length

9

ORF Length

60

Open Reading Frame (ORF)

LVCVGSYTGRGALEEKWCLRKITVNWQQARVQDVYPSTKFSQPALAMLLFYKLLYILYNI

Conservation Score

0.492

PhyloCSF Frame 1

0

No. of Spectra

69

CPC Coding Probability

0.124985

PhyloCSF Frame 2 

-4.96

CNTI Index

noncoding

Max Probability

0.9867

PhyloCSF Frame 3

-5.228

CNTI Score

-0.34649336