McDonnell Genome Institute

Washington University

Transcript

SMIM10L2B-AS1:7

Chromosome

chrX

Gene Name

SMIM10L2B-AS1

Start

135116757

CPC Label

noncoding

End

135123952

Cancer

OV

Strand

+

Peptide

HTINPPLPPGEDRK

Modified Peptide

n[145]HTINPPLPPGEDRK

Peptide Length

14

ORF Length

105

Open Reading Frame (ORF)

LWSQAVMAQGHSEVGPSTSAWSIRRKVDEYLRPSLASKSVLSVLLSRQLGNHRNDVDLTEWLWTLKQAIPGWTWPLPTRHTINPPLPPGEDRKSKKMVWINKSFP

Conservation Score

0.875

PhyloCSF Frame 1

-4.944

No. of Spectra

8

CPC Coding Probability

0.29267

PhyloCSF Frame 2 

-5.128

CNTI Index

noncoding

Max Probability

0.7946

PhyloCSF Frame 3

-0.193

CNTI Score

-0.374300348