McDonnell Genome Institute

Washington University

Transcript

SMG7-AS1:4

Chromosome

chr1

Gene Name

SMG7-AS1

Start

183460873

CPC Label

noncoding

End

183471746

Cancer

OV

Strand

-

Peptide

GTLLPLKYTSR

Modified Peptide

n[145]GTLLPLKYTSR

Peptide Length

11

ORF Length

65

Open Reading Frame (ORF)

LEEEKEEIDEQRSTLPGGSNSCQTPIYYNLFSMGDFKKRLDPQSVLKSRKGTLLPLKYTSRLSNL

Conservation Score

0.951

PhyloCSF Frame 1

-2.075

No. of Spectra

12

CPC Coding Probability

0.0758975

PhyloCSF Frame 2 

-3.451

CNTI Index

noncoding

Max Probability

0.8274

PhyloCSF Frame 3

-3.12

CNTI Score

-0.307148707