McDonnell Genome Institute

Washington University

Transcript

SMC5-AS1:11

Chromosome

chr9

Gene Name

SMC5-AS1

Start

70204534

CPC Label

noncoding

End

70223131

Cancer

CCRC

Strand

-

Peptide

LHSLAGK

Modified Peptide

n[230]LHSLAGK

Peptide Length

7

ORF Length

39

Open Reading Frame (ORF)

LHSLAGKEFLKIRGKRYQYFVKNNCRRCRSKISLYYTFK

Conservation Score

0.129

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.46957

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9931

PhyloCSF Frame 3

0

CNTI Score

-0.29980926