McDonnell Genome Institute

Washington University

Transcript

SMARCA5-AS1:2

Chromosome

chr4

Gene Name

SMARCA5-AS1

Start

143513471

CPC Label

noncoding

End

143514635

Cancer

CCRC

Strand

-

Peptide

HDVPSASPAAAR

Modified Peptide

‚Äč

Peptide Length

12

ORF Length

109

Open Reading Frame (ORF)

LRPIATIRRGSQLLLPAAPAPHAASRPHLHLGVCGTSAGRRRNRLRRDAFGAAFVAAVAPAAGDRGCGLGRRALGRRGWRRLGRGRHDVPSASPAAARGPSPAGMDGEA

Conservation Score

1

PhyloCSF Frame 1

-0.425

No. of Spectra

7

CPC Coding Probability

0.43758

PhyloCSF Frame 2 

1.316

CNTI Index

noncoding

Max Probability

0.9967

PhyloCSF Frame 3

6.684

CNTI Score

-0.291653454