McDonnell Genome Institute

Washington University

Transcript

SMAD1-AS2:4

Chromosome

chr4

Gene Name

SMAD1-AS2

Start

145494860

CPC Label

noncoding

End

145502971

Cancer

BRCA-Luminal B

Strand

-

Peptide

FEPLLVK

Modified Peptide

n[145]FEPLLVK

Peptide Length

7

ORF Length

45

Open Reading Frame (ORF)

LSISGLLRFEPLLVKGQLYSKTIKSHPYIILITTTTTIMNHHALF

Conservation Score

0.673

PhyloCSF Frame 1

-5.074

No. of Spectra

7

CPC Coding Probability

0.233348

PhyloCSF Frame 2 

-5.471

CNTI Index

noncoding

Max Probability

0.9995

PhyloCSF Frame 3

-4.763

CNTI Score

-0.334014506