McDonnell Genome Institute

Washington University

Transcript

SMAD1-AS1:1

Chromosome

chr4

Gene Name

SMAD1-AS1

Start

145514577

CPC Label

noncoding

End

145517194

Cancer

OV

Strand

-

Peptide

GMVTQLLGCPGQLK

Modified Peptide

n[145]GM[147]VTQLLGCPGQLK

Peptide Length

14

ORF Length

85

Open Reading Frame (ORF)

LPSRERGMVTQLLGCPGQLKAFSSSSMAPFFFFSFFTKASTAFSAHFSSSSPCFHPRSLFTAGLVKENKLVTFIMTALVILLGYG

Conservation Score

1

PhyloCSF Frame 1

10.933

No. of Spectra

5

CPC Coding Probability

0.293996

PhyloCSF Frame 2 

-3.982

CNTI Index

noncoding

Max Probability

0.8481

PhyloCSF Frame 3

-4.535

CNTI Score

-0.390712995