McDonnell Genome Institute

Washington University

Transcript

SLCO4A1-AS1:3

Chromosome

chr20

Gene Name

SLCO4A1-AS1

Start

62663030

CPC Label

noncoding

End

62666622

Cancer

OV

Strand

-

Peptide

AATPPPPPGASAESLQAVTR

Modified Peptide

n[145]AATPPPPPGASAESLQAVTR

Peptide Length

20

ORF Length

85

Open Reading Frame (ORF)

LAVTPAMGTLGQCSEKTRMPSRLTTVQNRQNLMTAEPRSLSLFTKKPPRKVPPPPAGTTRAATPPPPPGASAESLQAVTRTFVEA

Conservation Score

1

PhyloCSF Frame 1

-0.595

No. of Spectra

2

CPC Coding Probability

0.362417

PhyloCSF Frame 2 

-3.834

CNTI Index

noncoding

Max Probability

0.9681

PhyloCSF Frame 3

14.875

CNTI Score

-0.308333141