McDonnell Genome Institute

Washington University

Transcript

SLC8A1-AS1:11

Chromosome

chr2

Gene Name

SLC8A1-AS1

Start

40042349

CPC Label

noncoding

End

40105422

Cancer

OV

Strand

+

Peptide

STWLGADNVCIPR

Modified Peptide

n[145]STWLGADNVCIPR

Peptide Length

13

ORF Length

65

Open Reading Frame (ORF)

LESCSCCQAGVQWRDLGSLQPPPCGFKQFSCLSLPSSWDYRERSTWLGADNVCIPRADRTKSRQT

Conservation Score

0.289

PhyloCSF Frame 1

0

No. of Spectra

12

CPC Coding Probability

0.0340631

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8481

PhyloCSF Frame 3

0

CNTI Score

-0.359443121