McDonnell Genome Institute

Washington University

Transcript

SLC5A4-AS1:6

Chromosome

chr22

Gene Name

SLC5A4-AS1

Start

32205141

CPC Label

noncoding

End

32213444

Cancer

HCC

Strand

+

Peptide

DAGHSQSK

Modified Peptide

n[230]DAGHSQSK

Peptide Length

8

ORF Length

62

Open Reading Frame (ORF)

MHRKQTRDAGHSQSKWQVVLLPKGHCRGCSVALRCLGCPPGAVSWPGRPGRALWALLKVHFC

Conservation Score

0.086

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.230437

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9987

PhyloCSF Frame 3

0

CNTI Score

-0.262394037