McDonnell Genome Institute

Washington University

Transcript

SLC26A4-AS1:18

Chromosome

chr7

Gene Name

SLC26A4-AS1

Start

107657428

CPC Label

noncoding

End

107661801

Cancer

BRCA-Luminal A

Strand

-

Peptide

GLWEPATGALIPHGEEK

Modified Peptide

n[145]GLWEPATGALIPHGEEK

Peptide Length

17

ORF Length

150

Open Reading Frame (ORF)

LSLLAPRPECPADYPSAAFIALSEGSGTFYLRSNRHLGRRERHTQAAVFPNRSYQERNPTPPAFFPFPEPGRLRLLLAATQGPPGSSLIPLLISRVARSGAGQALWDSLKKSRARLEEEVRGLWEPATGALIPHGEEKRNNGQVSILISP

Conservation Score

1

PhyloCSF Frame 1

-1.623

No. of Spectra

1

CPC Coding Probability

0.296492

PhyloCSF Frame 2 

-3.607

CNTI Index

coding

Max Probability

0.5155

PhyloCSF Frame 3

2.292

CNTI Score

0.708808469