McDonnell Genome Institute

Washington University

Transcript

SLC25A34-AS1:7

Chromosome

chr1

Gene Name

SLC25A34-AS1

Start

15747976

CPC Label

coding

End

15749637

Cancer

OV

Strand

-

Peptide

LQVGARPSVHPPRPLTSSATSVLR

Modified Peptide

n[145]LQVGARPSVHPPRPLTSSATSVLR

Peptide Length

24

ORF Length

83

Open Reading Frame (ORF)

LVSIVRPSAVSQPGMGQDMATIHPRLQVGARPSVHPPRPLTSSATSVLRYYMPPHHSTQFSTQNGFAQSARSHVPQGTQPRPA

Conservation Score

0.664

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.803905

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8179

PhyloCSF Frame 3

0

CNTI Score

-0.335033308