McDonnell Genome Institute

Washington University

Transcript

SLC25A25-AS1:8

Chromosome

chr9

Gene Name

SLC25A25-AS1

Start

128108580

CPC Label

noncoding

End

128118693

Cancer

BRCA-Luminal A

Strand

-

Peptide

LEDLSDMR

Modified Peptide

n[145]LEDLSDMR

Peptide Length

8

ORF Length

66

Open Reading Frame (ORF)

LEDLSDMRNLGFLFLRQSLTLSPRLECSGMISAHHNLCLLGSSHSPASASGVAGIIGTCHHTWLST

Conservation Score

0.43

PhyloCSF Frame 1

0

No. of Spectra

29

CPC Coding Probability

0.21749

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9993

PhyloCSF Frame 3

0

CNTI Score

-0.316885885