McDonnell Genome Institute

Washington University

Transcript

SLC25A25-AS1:14

Chromosome

chr9

Gene Name

SLC25A25-AS1

Start

128106046

CPC Label

noncoding

End

128112131

Cancer

OV

Strand

-

Peptide

LMNVSCFFPGSTISSPK

Modified Peptide

n[145]LMNVSCFFPGSTISSPK

Peptide Length

17

ORF Length

67

Open Reading Frame (ORF)

LMNVSCFFPGSTISSPKGNHHSDFSHQRLEKYPNTWMYASRVPLAPAPRSFWWNGSATVRSPVGRHC

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.110619

PhyloCSF Frame 2 

1.904

CNTI Index

noncoding

Max Probability

0.9237

PhyloCSF Frame 3

0

CNTI Score

-0.296437661