McDonnell Genome Institute

Washington University

Transcript

SLC16A1-AS1:8

Chromosome

chr1

Gene Name

SLC16A1-AS1

Start

112956460

CPC Label

noncoding

End

112975430

Cancer

PRAD

Strand

+

Peptide

GLGRQMWGGANK

Modified Peptide

‚Äč

Peptide Length

12

ORF Length

79

Open Reading Frame (ORF)

LGVVAGACSRSYSGGLRQENGVNLGGGACSEPRSRHYTPAWATERHSVSKKKKGKKGLGRQMWGGANKTWQPADQSISA

Conservation Score

0.629

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0502001

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6129

PhyloCSF Frame 3

0

CNTI Score

-0.336745581