McDonnell Genome Institute

Washington University

Transcript

SLC16A1-AS1:5

Chromosome

chr1

Gene Name

SLC16A1-AS1

Start

112956428

CPC Label

noncoding

End

113002191

Cancer

OSCC

Strand

+

Peptide

TPYETMELK

Modified Peptide

n[145]TPYETMELK

Peptide Length

9

ORF Length

67

Open Reading Frame (ORF)

LKLESQPAKPSERRQLLPEGSCLLLLLSILWSLSERTPYETMELKLPFQILTLRSMHSGSKYSYSKS

Conservation Score

0.923

PhyloCSF Frame 1

-4.075

No. of Spectra

2

CPC Coding Probability

0.0585331

PhyloCSF Frame 2 

-5.687

CNTI Index

noncoding

Max Probability

0.9843

PhyloCSF Frame 3

-4.499

CNTI Score

-0.336745581