McDonnell Genome Institute

Washington University

Transcript

SLC16A1-AS1:1

Chromosome

chr1

Gene Name

SLC16A1-AS1

Start

112956414

CPC Label

noncoding

End

112964072

Cancer

OV

Strand

+

Peptide

GLTLTGGGDAR

Modified Peptide

n[145]GLTLTGGGDAR

Peptide Length

11

ORF Length

53

Open Reading Frame (ORF)

LPDSPLGPCLTSSRQSALVRDTTIGLTPQFLPEKKEKSPRGLTLTGGGDARAE

Conservation Score

0.565

PhyloCSF Frame 1

-1.415

No. of Spectra

1

CPC Coding Probability

0.105653

PhyloCSF Frame 2 

-2.836

CNTI Index

noncoding

Max Probability

0.9799

PhyloCSF Frame 3

-2.498

CNTI Score

-0.336745581