McDonnell Genome Institute

Washington University

Transcript

SIX3-AS1:7

Chromosome

chr2

Gene Name

SIX3-AS1

Start

44940153

CPC Label

noncoding

End

44941503

Cancer

OSCC

Strand

-

Peptide

LLFTPSPAK

Modified Peptide

n[145]LLFTPSPAK

Peptide Length

9

ORF Length

85

Open Reading Frame (ORF)

MRSWGPPSTDLGPAGRGASRGSRIPRVSGAREPEPNSQGAGGRSCLPHRCPWTAFTSTPSSSIRLLFTPSPAKEPRFPPPPCILK

Conservation Score

1

PhyloCSF Frame 1

-4.95

No. of Spectra

2

CPC Coding Probability

0.0611008

PhyloCSF Frame 2 

-3.549

CNTI Index

noncoding

Max Probability

0.6399

PhyloCSF Frame 3

-2.392

CNTI Score

-0.350475783