McDonnell Genome Institute

Washington University

Transcript

SIX3-AS1:10

Chromosome

chr2

Gene Name

SIX3-AS1

Start

44940261

CPC Label

noncoding

End

44941487

Cancer

OV

Strand

-

Peptide

SWGPPSTDLGPAGR

Modified Peptide

n[145]SWGPPSTDLGPAGR

Peptide Length

14

ORF Length

90

Open Reading Frame (ORF)

MRSWGPPSTDLGPAGRGASRGSRIPRNSAASLRSGGGAAGAEKPKSPLDPEKSYRCPLLTTQQKELWSCLPAPEGTQTLEASHPDEVNKA

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

54

CPC Coding Probability

0.112867

PhyloCSF Frame 2 

-2.862

CNTI Index

noncoding

Max Probability

0.7757

PhyloCSF Frame 3

-2.392

CNTI Score

-0.350371649