McDonnell Genome Institute

Washington University

Transcript

SIX3-AS1:1

Chromosome

chr2

Gene Name

SIX3-AS1

Start

44940660

CPC Label

noncoding

End

44942674

Cancer

OV

Strand

-

Peptide

DVVEVAEVAR

Modified Peptide

n[145]DVVEVAEVAR

Peptide Length

10

ORF Length

168

Open Reading Frame (ORF)

LVVRLEPHGLQLAVRLLGELVVLKDVVEVAEVARVEGDHGARAQDRLVFVDGLARPGGHGQRPEEAAQPLDVARLLQRLTDAGHLLRREVEGGQLEHGQLFRGGPGAAAAAAACSASTAASRTVPAAAAASRAAAASRTVPAAATRQKYGAVVRIGEVWQQEVGGIEV

Conservation Score

1

PhyloCSF Frame 1

5.646

No. of Spectra

1

CPC Coding Probability

0.253464

PhyloCSF Frame 2 

10.592

CNTI Index

noncoding

Max Probability

0.7525

PhyloCSF Frame 3

2.309

CNTI Score

-0.250782293