McDonnell Genome Institute

Washington University

Transcript

SIRPG-AS1:1

Chromosome

chr20

Gene Name

SIRPG-AS1

Start

1633507

CPC Label

noncoding

End

1648472

Cancer

BRCA-Basal-like

Strand

+

Peptide

TELAVDMITRLPYISDYRR

Modified Peptide

n[145]TELAVDM[147]ITRLPYISDYRR

Peptide Length

19

ORF Length

61

Open Reading Frame (ORF)

MTELAVDMITRLPYISDYRRYFLPSISYIYSSSRQGHGKIRDLALTQQIRLTTISTVFERK

Conservation Score

0.136

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0522708

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9956

PhyloCSF Frame 3

0

CNTI Score

-0.362138518