McDonnell Genome Institute

Washington University

Transcript

SH3TC2-DT:38

Chromosome

chr5

Gene Name

SH3TC2-DT

Start

149063454

CPC Label

noncoding

End

149109787

Cancer

OSCC

Strand

+

Peptide

KVSSICPLQGLGR

Modified Peptide

n[145]KVSSICPLQGLGR

Peptide Length

13

ORF Length

99

Open Reading Frame (ORF)

LGNMQTPSCWCAGKESRRSPDEAQHFTEQSGERTLVRGPKNRRCEPREGPARPMLQAIWRLNLRKTDVSFLKKVSSICPLQGLGRKSIHFPRCLPLTYL

Conservation Score

0.155

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.210997

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7084

PhyloCSF Frame 3

0

CNTI Score

-0.326140194