McDonnell Genome Institute

Washington University

Transcript

SH3RF3-AS1:1

Chromosome

chr2

Gene Name

SH3RF3-AS1

Start

109127327

CPC Label

coding

End

109130119

Cancer

OV

Strand

-

Peptide

MPSSSRTSKMLAGSSSTPQPTR

Modified Peptide

n[145]MPSSSRTSKMLAGSSSTPQPTR

Peptide Length

22

ORF Length

339

Open Reading Frame (ORF)

MPSSSRTSKMLAGSSSTPQPTRMRHSGQRSSWREHTMLSRQRRQKVCWHGSTLAVVSRRSRHTEHSSRSSSDDSSMSSPAPAAVAAARRRRRSPGLSSSPSLCAAAAAALDAHSQDAPSSMGEAPAAVSRGCLGPGAGVEPATGSQHQDWGAGLRRDFLHPGWWPDARAVAVRSGSPTGLRGGDRPAWRGPASRARPVLSAAPAAAGYTCPAASPPRAGDRGCCRARSSTGSVLQAAARAWETSGRKCGQRPARSPGRPGRGVHAPPRSWRAAPPPRHLHAPLACSLVAVLQRIQQDRSSSSAASTCAGVRAEVTVTAGLREGGAVPAGLPFAWAQAGD

Conservation Score

1

PhyloCSF Frame 1

-1.031

No. of Spectra

1

CPC Coding Probability

0.911322

PhyloCSF Frame 2 

10.946

CNTI Index

coding

Max Probability

0.0504

PhyloCSF Frame 3

1.697

CNTI Score

0.807602104