McDonnell Genome Institute

Washington University

Transcript

SH3PXD2A-AS1:2

Chromosome

chr10

Gene Name

SH3PXD2A-AS1

Start

103746778

CPC Label

noncoding

End

103755409

Cancer

HCC

Strand

+

Peptide

SWGRPSVCISNK

Modified Peptide

n[230]SWGRPSVCISNK

Peptide Length

12

ORF Length

55

Open Reading Frame (ORF)

LMDLQTLLLQLYGAHKSPVHVKMQTVTYRSWGRPSVCISNKLPDDGHTADLRTTF

Conservation Score

0.053

PhyloCSF Frame 1

-4.657

No. of Spectra

62

CPC Coding Probability

0.0447874

PhyloCSF Frame 2 

-4.686

CNTI Index

noncoding

Max Probability

0.9975

PhyloCSF Frame 3

-3.45

CNTI Score

-0.326277254