McDonnell Genome Institute

Washington University

Transcript

SGMS1-AS1:2

Chromosome

chr10

Gene Name

SGMS1-AS1

Start

50624950

CPC Label

noncoding

End

50641451

Cancer

OSCC

Strand

+

Peptide

GSQVQTMNPNGRAAR

Modified Peptide

n[145]GSQVQTM[147]NPNGRAAR

Peptide Length

15

ORF Length

60

Open Reading Frame (ORF)

LGRCNYKQPNKGSQVQTMNPNGRAARHERPCCPSTPQYFTSGSLDNSREYLQNPAPTQNF

Conservation Score

0.2

PhyloCSF Frame 1

-4.4

No. of Spectra

52

CPC Coding Probability

0.192998

PhyloCSF Frame 2 

-5.462

CNTI Index

noncoding

Max Probability

0.9197

PhyloCSF Frame 3

-5.537

CNTI Score

-0.323709143