McDonnell Genome Institute

Washington University

Transcript

SFTPD-AS1:1

Chromosome

chr10

Gene Name

SFTPD-AS1

Start

79968212

CPC Label

noncoding

End

79973213

Cancer

OV

Strand

+

Peptide

MTLHLPNSLSMR

Modified Peptide

n[145]MTLHLPNSLSMR

Peptide Length

12

ORF Length

86

Open Reading Frame (ORF)

MSISLARLKKFLAIILFNRFSMPLFIFFPSGIHRKMTLHLPNSLSMRINFRPCLTCCKAHQGIIFRRKVSVLLHQFRPPLLDAKLV

Conservation Score

0.66

PhyloCSF Frame 1

0

No. of Spectra

8

CPC Coding Probability

0.287972

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9544

PhyloCSF Frame 3

0

CNTI Score

-0.368034174