McDonnell Genome Institute

Washington University

Transcript

SEC24B-AS1:22

Chromosome

chr4

Gene Name

SEC24B-AS1

Start

109346325

CPC Label

coding

End

109347459

Cancer

BRCA-Luminal A

Strand

-

Peptide

RGLPPPPRSR

Modified Peptide

n[145]RGLPPPPRSR

Peptide Length

10

ORF Length

151

Open Reading Frame (ORF)

LMKEHETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQATKPSFESGRRGLPPPPRSRGPPKGLRGGRGRSGGTRRPPSWRRHMDDSGYSMNFNMSSSRGPLPVKRRPPPRSGGPPPKSSAPSGPVRSSSGMGGRAPVSRGRDS

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.911027

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4011

PhyloCSF Frame 3

0

CNTI Score

-0.315233667